PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG012885.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family VOZ
Protein Properties Length: 449aa    MW: 49977.1 Da    PI: 5.3516
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG012885.1genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ452.54.5e-1392104261217
          VOZ   1 pppsaflgpkcalwdctrpaqgsewlqdycssfhatlalneglpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaatakspwnaaelfdl 98 
                  pppsaf+gpkcalwdctrpaqgsew++dycssfhatlalneg+pg+tpvlrp+gi+lkd+llf+al ak+qgk+vgip+cegaa +kspwnaaelfdl
  CCG012885.1 210 PPPSAFMGPKCALWDCTRPAQGSEWCKDYCSSFHATLALNEGPPGMTPVLRPRGINLKDNLLFDALAAKMQGKNVGIPQCEGAAVMKSPWNAAELFDL 307
                  89************************************************************************************************ PP

          VOZ  99 sllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlyeyeineldalalyrlelklvdekksa 196
                  sllegetirewlffdkprraf+sgnrkqrslpdysgrgwhesrkqvmke+gg+k+syymdpqp++++ewhlyeyein++da+alyrle+kl+d+kk++
  CCG012885.1 308 SLLEGETIREWLFFDKPRRAFDSGNRKQRSLPDYSGRGWHESRKQVMKELGGKKKSYYMDPQPPGCHEWHLYEYEINNCDACALYRLEFKLADGKKTP 405
                  ************************************************************************************************** PP

          VOZ 197 kgkvskdsladlqkklgrlta 217
                  kgkvskdsladlqkk+grlta
  CCG012885.1 406 KGKVSKDSLADLQKKMGRLTA 426
                  *******************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 449 aa     Download sequence    Send to blast
MQKGGKSKCA STSHHLLMDN AKNRLNDLEE RFFNIQAARK EGRNNDVALL EEQVCQSLRE  60
WKAELDVPSP ANSLLDISLG SFSEDIGRLL QLYEEEDDAI SPLTMQSVLK PETQPEPNFQ  120
NLNLGNLTTF QDEYLVNSHS QELGFQGFHQ PNGPSGLQNV AVSDPDITTL LDCHQFTLDE  180
EFDPGHFVGT NDTKECGINA ESNNLQYISP PPSAFMGPKC ALWDCTRPAQ GSEWCKDYCS  240
SFHATLALNE GPPGMTPVLR PRGINLKDNL LFDALAAKMQ GKNVGIPQCE GAAVMKSPWN  300
AAELFDLSLL EGETIREWLF FDKPRRAFDS GNRKQRSLPD YSGRGWHESR KQVMKELGGK  360
KKSYYMDPQP PGCHEWHLYE YEINNCDACA LYRLEFKLAD GKKTPKGKVS KDSLADLQKK  420
MGRLTAVVTA DNSPSDKGKT NTSGTGHGP
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2131561e-171AC213156.1 Populus trichocarpa clone POP076-I18, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011002664.10.0PREDICTED: transcription factor VOZ1-like
RefseqXP_011002665.10.0PREDICTED: transcription factor VOZ1-like
SwissprotQ9SGQ01e-174VOZ1_ARATH; Transcription factor VOZ1
TrEMBLB9IQS10.0B9IQS1_POPTR; Uncharacterized protein
STRINGPOPTR_0019s12260.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF14983494
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.21e-175vascular plant one zinc finger protein